PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0614s0190.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 245aa    MW: 28025.1 Da    PI: 7.3902
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0614s0190.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.61.2e-49201461128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrF+Ptdeelv +yLk+k+ + +l++ +vi++v+++k++Pw+Lp  +   e+e yfF+++++ky++g+r nr+ +sgyWk+tg
  SapurV1A.0614s0190.1.p  20 LPPGFRFQPTDEELVFQYLKRKILSCPLPT-SVIPDVNVCKYDPWELPGDM---ESERYFFCNKETKYPNGNRVNRSSASGYWKSTG 102
                             79***************************9.99***************554...5799***************************** PP

                     NAM  88 kdkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk+++s+   ++++vg+kktLvfy+g+ap+ ++tdWvmheyrl
  SapurV1A.0614s0190.1.p 103 SDKQIISSrwkNSHAVGMKKTLVFYRGKAPRCSRTDWVMHEYRL 146
                             ******998888899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-5716183IPR003441NAC domain
PROSITE profilePS5100555.17420183IPR003441NAC domain
PfamPF023651.2E-2621146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MERVFGMEMF NFIRDGTNRL PPGFRFQPTD EELVFQYLKR KILSCPLPTS VIPDVNVCKY  60
DPWELPGDME SERYFFCNKE TKYPNGNRVN RSSASGYWKS TGSDKQIISS RWKNSHAVGM  120
KKTLVFYRGK APRCSRTDWV MHEYRLVNAG EETTDCNFPQ TENSAQNSSY QLDNWVVCRV  180
FLKNKGGTRN EIIETCTNNH ARRTQPGLFD PVSSHSSSSS NSSSITDISS NEEDDELSSS  240
HNFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-482018417166NAC domain-containing protein 19
4dul_A2e-482018417166NAC domain-containing protein 19
1ut7_B2e-482018417166NO APICAL MERISTEM PROTEIN
1ut7_A2e-482018417166NO APICAL MERISTEM PROTEIN
1ut4_B2e-482018417166NO APICAL MERISTEM PROTEIN
1ut4_A2e-482018417166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7700130.0KP770013.1 Populus tomentosa trans-cinnamate 4-monooxygenase (Potri.015G102100) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011023926.11e-135PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY931e-70NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0F6V0521e-130A0A0F6V052_POPTO; Trans-cinnamate 4-monooxygenase
STRINGPOPTR_0012s10530.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.19e-71NAC domain containing protein 83